General Information of This Peptide
Peptide ID
BTDP008336
Peptide Name
Alpha-conotoxin GI
Symonym
G1
Species
Conus geographus (Geography cone) (Nubecula geographus)
Uniprot Name
CA1_CONGE
Alphafold ID
X5I9Y2
3D Structure
Download
2D Sequence
3D Structure
Source
RSCB PDB: 1NOT
Sequence
MGMRMMFTVFLLVVLATTVVSFPSERASDGRDDTAKDEGSDMDKLVEKKECCNPACGRHY
SCGR
   Click to Show/Hide
Sequence Length
64
Mass (Da)
7094
Signal Sequence
MGMRMMFTVFLLVVLATTVVS
   Click to Show/Hide
Sequence Removed Signal Peptide
FPSERASDGRDDTAKDEGSDMDKLVEKKECCNPACGRHYSCGR
   Click to Show/Hide
Disulfide Bond
51-56;52-62
PDB ID
1NOT , 1QS3 , 1XGA , 1XGB , 1XGC , 2FR9 , 2FRB
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Mollusca
Class: Gastropoda
Order: Neogastropoda
Family: Conidae
Genus: Conus
Species: Conus geographus
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    nAChR alpha-1-beta-1-delta-epsilon IC50
5.86 - 995 nM
.
Fetal subtype
[1- 18]
 Target Info    nAChR alpha-1-beta-1-gamma-delta IC50
339 nM
.
Adult subtype
[1- 18]
References
Ref 1 Evolution of separate predation- and defence-evoked venoms in carnivorous cone snails. Nat Commun. 2014 Mar 24;5:3521. doi: 10.1038/ncomms4521.
Ref 2 Peptide toxins from Conus geographus venom. J Biol Chem. 1981 May 25;256(10):4734-40.
Ref 3 Primary and secondary structure of conotoxin GI, a neurotoxic tridecapeptide from a marine snail. FEBS Lett. 1982 Nov 8;148(2):260-2. doi: 10.1016/0014-5793(82)80820-x.
Ref 4 Conotoxin GI: disulfide bridges, synthesis, and preparation of iodinated derivatives. Biochemistry. 1984 Jun 5;23(12):2796-802. doi: 10.1021/bi00307a040.
Ref 5 The alpha-conotoxins GI and MI distinguish between the nicotinic acetylcholine receptor agonist sites while SI does not. Biochemistry. 1994 Nov 29;33(47):14058-63. doi: 10.1021/bi00251a014.
Ref 6 alpha-Conotoxins selectively inhibit one of the two acetylcholine binding sites of nicotinic receptors. Mol Pharmacol. 1995 Jul;48(1):105-11.
Ref 7 Determinants involved in the affinity of alpha-conotoxins GI and SI for the muscle subtype of nicotinic acetylcholine receptors. Biochemistry. 1997 May 27;36(21):6469-74. doi: 10.1021/bi970195w.
Ref 8 Role of hydroxyprolines in the in vitro oxidative folding and biological activity of conotoxins. Biochemistry. 2008 Feb 12;47(6):1741-51. doi: 10.1021/bi701934m. Epub 2008 Jan 12.
Ref 9 Modulation of conotoxin structure and function is achieved through a multienzyme complex in the venom glands of cone snails. J Biol Chem. 2012 Oct 5;287(41):34288-303. doi: 10.1074/jbc.M112.366781. Epub 2012 Aug 13.
Ref 10 Alanine-Scanning Mutagenesis of -Conotoxin GI Reveals the Residues Crucial for Activity at the Muscle Acetylcholine Receptor. Mar Drugs. 2018 Dec 13;16(12):507. doi: 10.3390/md16120507.
Ref 11 Globular and ribbon isomers of Conus geographus -conotoxins antagonize human nicotinic acetylcholine receptors. Biochem Pharmacol. 2021 Aug;190:114638. doi: 10.1016/j.bcp.2021.114638. Epub 2021 May 29.
Ref 12 Cysteine-Rich -Conotoxin SII Displays Novel Interactions at the Muscle Nicotinic Acetylcholine Receptor. ACS Chem Neurosci. 2022 Apr 20;13(8):1245-1250. doi: 10.1021/acschemneuro.1c00857. Epub 2022 Mar 31.
Ref 13 Three-dimensional structure of the alpha-conotoxin GI at 1.2 A resolution. Biochemistry. 1996 Sep 3;35(35):11329-35. doi: 10.1021/bi960820h.
Ref 14 Solution conformation of conotoxin GI determined by 1H nuclear magnetic resonance spectroscopy and distance geometry calculations. Biochemistry. 1989 May 30;28(11):4853-60. doi: 10.1021/bi00437a050.
Ref 15 Solution structures of alpha-conotoxin G1 determined by two-dimensional NMR spectroscopy. Biochemistry. 1989 Jun 27;28(13):5494-501. doi: 10.1021/bi00439a026.
Ref 16 Two distinct structures of alpha-conotoxin GI in aqueous solution. Eur J Biochem. 1998 Jun 1;254(2):238-47. doi: 10.1046/j.1432-1327.1998.2540238.x.
Ref 17 Structure determination of the three disulfide bond isomers of alpha-conotoxin GI: a model for the role of disulfide bonds in structural stability. J Mol Biol. 1998 May 1;278(2):401-15. doi: 10.1006/jmbi.1998.1701.
Ref 18 NMR solution conformation of an antitoxic analogue of alpha-conotoxin GI: identification of a common nicotinic acetylcholine receptor alpha 1-subunit binding surface for small ligands and alpha-conotoxins. Biochemistry. 1999 Sep 14;38(37):11895-904. doi: 10.1021/bi990558n.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.