Peptide Information

General Information of This Peptide
Peptide ID
BTDP006131
Peptide Name
Basic phospholipase A2 VRV-PL-VIIIa
Symonym
DPLA2; P1; Phosphatidylcholine 2-acylhydrolase; Phospholipase A2 4
Species
Daboia russelii (Russel's viper) (Vipera russelii)
Uniprot Name
PA2B8_DABRR
Alphafold ID
P59071
3D Structure
Download
2D Sequence
3D Structure
Source
RSCB PDB: 1CL5
Sequence
SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCCYGNLPDCNPK
SDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNLNTYSKKYMLYPDFLCKGELK
C
   Click to Show/Hide
Sequence Length
121
Mass (Da)
13611
Sequence Removed Signal Peptide
SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCCYGNLPDCNPK
SDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNLNTYSKKYMLYPDFLCKGELK
C
   Click to Show/Hide
Disulfide Bond
26-115;28-44;43-95;49-121;50-88;57-81;75-86
PDB ID
1CL5 , 1FB2 , 1FV0 , 1JQ8 , 1JQ9 , 1KPM , 1OXL , 1OYF , 1Q6V , 1Q7A , 1SKG , 1SQZ , 1SV3 , 1SV9 , 1SXK , 1TDV , 1TG1 , 1TG4 , 1TGM , 1TH6 , 1TJ9 , 1TJK , 1TK4 , 1TP2 , 1Y38 , 1ZR8 , 1ZWP , 1ZYX , 2ARM , 2B17 , 2DO2 , 2DPZ , 2FNX , 2G58 , 2GNS , 2O1N , 2OLI , 2OTF , 2OTH , 2OUB , 2OYF , 2PB8 , 2PMJ , 2PVT , 2PWS , 2PYC , 2Q1P , 2QHW , 2QU9 , 2QUE , 2QVD , 2ZBH , 3CBI , 3FO7 , 3G8F , 3H1X , 4EIX , 4FGA , 4GFY , 4GLD , 4HMB , 4QEM , 4QER , 4QF7 , 4QF8 , 4QGD , 4QMC , 5VET
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Lepidosauria
Order: Squamata
Family: Viperidae
Genus: Daboia
Species: Daboia russelii
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    factor Xa (F10) IC50
130 nM
 .
Prothrombinase activity
 [1- 14]
References
Ref 1 Primary sequence determination of the most basic myonecrotic phospholipase A2 from the venom of Vipera russelli. Toxicon. 1994 Jun;32(6):665-73. doi: 10.1016/0041-0101(94)90336-0.
Ref 2 Two types of Russell's viper revealed by variation in phospholipases A2 from venom of the subspecies. Toxicon. 1996 Jan;34(1):99-109. doi: 10.1016/0041-0101(95)00114-x.
Ref 3 Molecular diversity in venom proteins of the Russell's viper (Daboia russellii russellii) and the Indian cobra (Naja naja) in Sri Lanka. Biomed Res. 2010 Feb;31(1):71-81. doi: 10.2220/biomedres.31.71.
Ref 4 Purification and characterization of a major phospholipase A2 from Russell's viper (Vipera russelli) venom. Toxicon. 1989;27(2):229-37. doi: 10.1016/0041-0101(89)90136-0.
Ref 5 Antibodies to a phospholipase A2 from Vipera russelli selectively neutralize venom neurotoxicity. Immunology. 1990 Jun;70(2):175-80.
Ref 6 Characterization of a human coagulation factor Xa-binding site on Viperidae snake venom phospholipases A2 by affinity binding studies and molecular bioinformatics. BMC Struct Biol. 2007 Dec 6;7:82. doi: 10.1186/1472-6807-7-82.
Ref 7 Three-dimensional structure of a presynaptic neurotoxic phospholipase A2 from Daboia russelli pulchella at 2.4 A resolution. J Mol Biol. 2000 Mar 3;296(4):1117-26. doi: 10.1006/jmbi.2000.3537.
Ref 8 Regulation of catalytic function by molecular association: structure of phospholipase A2 from Daboia russelli pulchella (DPLA2) at 1.9 A resolution. Acta Crystallogr D Biol Crystallogr. 2001 Dec;57(Pt 12):1793-8. doi: 10.1107/s0907444901014524. Epub 2001 Nov 21.
Ref 9 Design of specific peptide inhibitors of phospholipase A2: structure of a complex formed between Russell's viper phospholipase A2 and a designed peptide Leu-Ala-Ile-Tyr-Ser (LAIYS). Acta Crystallogr D Biol Crystallogr. 2002 Oct;58(Pt 10 Pt 2):1813-9. doi: 10.1107/s0907444902013720. Epub 2002 Sep 28.
Ref 10 Structural basis of phospholipase A2 inhibition for the synthesis of prostaglandins by the plant alkaloid aristolochic acid from a 1.7 A crystal structure. Biochemistry. 2002 Sep 10;41(36):10914-9. doi: 10.1021/bi0258593.
Ref 11 Crystal structure of a complex formed between a snake venom phospholipase A(2) and a potent peptide inhibitor Phe-Leu-Ser-Tyr-Lys at 1.8 A resolution. J Biol Chem. 2002 Oct 25;277(43):41079-85. doi: 10.1074/jbc.M206130200. Epub 2002 Aug 16.
Ref 12 Phospholipase A2 as a target protein for nonsteroidal anti-inflammatory drugs (NSAIDS): crystal structure of the complex formed between phospholipase A2 and oxyphenbutazone at 1.6 A resolution. Biochemistry. 2004 Nov 23;43(46):14577-83. doi: 10.1021/bi0483561.
Ref 13 Crystal structures of the complexes of a group IIA phospholipase A2 with two natural anti-inflammatory agents, anisic acid, and atropine reveal a similar mode of binding. Proteins. 2006 Jul 1;64(1):89-100. doi: 10.1002/prot.20970.
Ref 14 Structures and binding studies of the complexes of phospholipase A2 with five inhibitors. Biochim Biophys Acta. 2015 Apr;1854(4):269-77. doi: 10.1016/j.bbapap.2014.12.017. Epub 2014 Dec 23.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.