General Information of This Peptide
Peptide ID
BTDP006040
Peptide Name
Alpha-conotoxin MII
Symonym
Alpha-Ctx MII; Alpha-MII
Species
Conus magus (Magical cone)
Uniprot Name
CA12_CONMA
Alphafold ID
P56636
3D Structure
Download
2D Sequence
3D Structure
Source
RSCB PDB: 1M2C
Sequence
MGMRMMFTVFLLVVLATTVVSFPSDRASDGRNAAANDKASDVITLALKGCCSNPVCHLEH
SNLCGRRR
   Click to Show/Hide
Sequence Length
68
Mass (Da)
7357
Signal Sequence
MGMRMMFTVFLLVVLATTVVS
   Click to Show/Hide
Sequence Removed Signal Peptide
FPSDRASDGRNAAANDKASDVITLALKGCCSNPVCHLEHSNLCGRRR
   Click to Show/Hide
Disulfide Bond
50-56;51-64
PDB ID
1M2C , 1MII , 2AJW , 2AK0
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Mollusca
Class: Gastropoda
Order: Neogastropoda
Family: Conidae
Genus: Conus
Species: Conus magus
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    nAChR alpha-6/alpha-3-beta-2-beta-3 IC50
0.39 nM
. . [1- 15]
 Target Info    nAChR alpha-6/alpha-3-beta-4 IC50
1.49 nM
. . [1- 15]
References
Ref 1 The A-superfamily of conotoxins: structural and functional divergence. J Biol Chem. 2004 Apr 23;279(17):17596-606. doi: 10.1074/jbc.M309654200. Epub 2003 Dec 30.
Ref 2 Alpha-conotoxin GIC from Conus geographus, a novel peptide antagonist of nicotinic acetylcholine receptors. J Biol Chem. 2002 Sep 13;277(37):33610-5. doi: 10.1074/jbc.M205102200. Epub 2002 Jul 11.
Ref 3 A new alpha-conotoxin which targets alpha3beta2 nicotinic acetylcholine receptors. J Biol Chem. 1996 Mar 29;271(13):7522-8. doi: 10.1074/jbc.271.13.7522.
Ref 4 Human alpha6 AChR subtypes: subunit composition, assembly, and pharmacological responses. Neuropharmacology. 2000 Oct;39(13):2570-90. doi: 10.1016/s0028-3908(00)00144-1.
Ref 5 Analogs of alpha-conotoxin MII are selective for alpha6-containing nicotinic acetylcholine receptors. Mol Pharmacol. 2004 Apr;65(4):944-52. doi: 10.1124/mol.65.4.944.
Ref 6 Beta2 subunit contribution to 4/7 alpha-conotoxin binding to the nicotinic acetylcholine receptor. J Biol Chem. 2005 Aug 26;280(34):30460-8. doi: 10.1074/jbc.M504229200. Epub 2005 Jun 1.
Ref 7 Determinants of alpha-conotoxin BuIA selectivity on the nicotinic acetylcholine receptor beta subunit. Biochemistry. 2006 Sep 19;45(37):11200-7. doi: 10.1021/bi0611715.
Ref 8 Determinants of potency on alpha-conotoxin MII, a peptide antagonist of neuronal nicotinic receptors. Biochemistry. 2004 Mar 16;43(10):2732-7. doi: 10.1021/bi036180h.
Ref 9 Atypical alpha-conotoxin LtIA from Conus litteratus targets a novel microsite of the alpha3beta2 nicotinic receptor. J Biol Chem. 2010 Apr 16;285(16):12355-66. doi: 10.1074/jbc.M109.079012. Epub 2010 Feb 9.
Ref 10 Inhibition of cholinergic pathways in Drosophila melanogaster by -conotoxins. FASEB J. 2015 Mar;29(3):1011-8. doi: 10.1096/fj.14-262733. Epub 2014 Dec 2.
Ref 11 -Conotoxins Enhance both the In Vivo Suppression of Ehrlich carcinoma Growth and In Vitro Reduction in Cell Viability Elicited by Cyclooxygenase and Lipoxygenase Inhibitors. Mar Drugs. 2020 Apr 7;18(4):193. doi: 10.3390/md18040193.
Ref 12 Computational and Functional Mapping of Human and Rat 64 Nicotinic Acetylcholine Receptors Reveals Species-Specific Ligand-Binding Motifs. J Med Chem. 2021 Feb 11;64(3):1685-1700. doi: 10.1021/acs.jmedchem.0c01973. Epub 2021 Feb 1.
Ref 13 Three-dimensional solution structure of alpha-conotoxin MII, an alpha3beta2 neuronal nicotinic acetylcholine receptor-targeted ligand. Biochemistry. 1997 Dec 16;36(50):15693-700. doi: 10.1021/bi971443r.
Ref 14 Three-dimensional solution structure of alpha-conotoxin MII by NMR spectroscopy: effects of solution environment on helicity. Biochemistry. 1998 Nov 10;37(45):15621-30. doi: 10.1021/bi981535w.
Ref 15 Engineering stable peptide toxins by means of backbone cyclization: stabilization of the alpha-conotoxin MII. Proc Natl Acad Sci U S A. 2005 Sep 27;102(39):13767-72. doi: 10.1073/pnas.0504613102. Epub 2005 Sep 14.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.