General Information of This Peptide
Peptide ID
BTDP000901
Peptide Name
Potassium channel toxin alpha-KTx 2.5
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Sequence
TVIDVKCTSPKQCLPPCKAQFGIRAGAKCMNGKCKCYPH
   Click to Show/Hide
Sequence Length
39
Mass (Da)
4220
Sequence Removed Signal Peptide
TVIDVKCTSPKQCLPPCKAQFGIRAGAKCMNGKCKCYPH
   Click to Show/Hide
        Click to Show/Hide the Complete Species Lineage
N.A.
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    KcsA-Kv1.3 Dissociation constant
8.4 nM
.
Blocker
[1- 20]
 Target Info    KcsA-Kv1.1 Dissociation constant
44 nM
.
Blocker
[1- 20]
References
Ref 1 Erratum: The shape of lipsmacking: socio-emotional regulation in bearded capuchin monkeys (Sapajus libidinosus) - CORRIGENDUM. Evol Hum Sci. 2024 Mar 4;6:e13. doi: 10.1017/ehs.2024.4. eCollection 2024.
Ref 2 Erratum: As a mature scientific discipline animal welfare must be subject to debate and opinion - ERRATUM. Anim Welf. 2023 Nov 8;32:e74. doi: 10.1017/awf.2023.96. eCollection 2023.
Ref 3 Erratum: Identifying areas of animal welfare concern in different production stages in Danish pig herds using the Danish Animal Welfare Index (DAWIN) - CORRIGENDUM. Anim Welf. 2023 Sep 4;32:e58. doi: 10.1017/awf.2023.78. eCollection 2023.
Ref 4 Erratum: An effective environmental enrichment framework for the continual improvement of production animal welfare - ERRATUM. Anim Welf. 2023 Mar 1;32:e25. doi: 10.1017/awf.2023.23. eCollection 2023.
Ref 5 Erratum: One welfare: Linking poverty, equid ownership and equid welfare in the brick kilns of India - ERRATUM. Anim Welf. 2023 Feb 15;32:e15. doi: 10.1017/awf.2023.14. eCollection 2023.
Ref 6 Erratum: Welfare of dairy cows in Kosovo and intervention thresholds for selected welfare indicators as suggested by farmers and veterinarians - ERRATUM. Anim Welf. 2023 Feb 15;32:e16. doi: 10.1017/awf.2023.15. eCollection 2023.
Ref 7 Erratum: Clinical trials landscape in lower middle-income country (Pakistan) - CORRIGENDUM. J Clin Transl Sci. 2024 Feb 22;8(1):e35. doi: 10.1017/cts.2024.22. eCollection 2024.
Ref 8 Erratum: Pharmacist interventions for appropriate COVID-19 antiviral therapy in long-term care facilities: A public health initiative - ERRATUM. Antimicrob Steward Healthc Epidemiol. 2024 Feb 8;4(1):e19. doi: 10.1017/ash.2024.22. eCollection 2024.
Ref 9 Erratum: Potassium intake is associated with nutritional quality and actual diet cost: a study at formulating a low sodium high potassium (LSHP) healthy diet - CORRIGENDUM. J Nutr Sci. 2024 Feb 8;13:e7. doi: 10.1017/jns.2024.3. eCollection 2024.
Ref 10 Erratum: Moving psychiatric deinstitutionalization forward: A scoping review of barriers and facilitators - CORRIGENDUM. Glob Ment Health (Camb). 2023 Dec 13;10:e82. doi: 10.1017/gmh.2023.87. eCollection 2023.
Ref 11 Erratum: Importance of Palm's heart for pregnant women - CORRIGENDUM. J Nutr Sci. 2023 Dec 11;12:e122. doi: 10.1017/jns.2023.110. eCollection 2023.
Ref 12 Erratum: Perspectives on research needs in healthcare epidemiology, infection prevention, and antimicrobial stewardship: what's on the horizon-Part I - CORRIGENDUM. Antimicrob Steward Healthc Epidemiol. 2023 Nov 30;3(1):e218. doi: 10.1017/ash.2023.513. eCollection 2023.
Ref 13 Erratum: COVID-19 fear and its associated correlates among type-2 diabetes patients in Bangladesh: A hospital-based study - CORRIGENDUM. Glob Ment Health (Camb). 2023 Oct 16;10:e65. doi: 10.1017/gmh.2023.60. eCollection 2023.
Ref 14 Erratum: Building the foundation for equitable and inclusive research: Seed grant programs to facilitate development of diverse CBPR community-academic research partnerships - CORRIGENDUM. J Clin Transl Sci. 2023 Oct 25;7(1):e216. doi: 10.1017/cts.2023.636. eCollection 2023.
Ref 15 Process evaluation of an academic dissemination and implementation science capacity building program. J Clin Transl Sci. 2023 Sep 15;7(1):e207. doi: 10.1017/cts.2023.630. eCollection 2023.
Ref 16 Erratum: A community health volunteer delivered problem-solving therapy mobile application based on the Friendship Bench 'Inuka Coaching' in Kenya: A pilot cohort study - CORRIGENDUM. Glob Ment Health (Camb). 2023 Sep 15;10:e54. doi: 10.1017/gmh.2023.54. eCollection 2023.
Ref 17 Erratum: Opportunities for improving data sharing and FAIR data practices to advance global mental health-Corrigendum. Glob Ment Health (Camb). 2023 Apr 24;10:e20. doi: 10.1017/gmh.2023.14. eCollection 2023.
Ref 18 Erratum: 53 The development of a multi-institutional prospective registry for patients with metastatic invasive lobular carcinoma: identifying new markers of disease progression - CORRIGENDUM. J Clin Transl Sci. 2023 Sep 28;7(1):e202. doi: 10.1017/cts.2023.637. eCollection 2023.
Ref 19 Erratum: SG-APSIC1064: The role of infection control activities on healthcare-associated infections during 2017-2021 at intensive care units in Cho Ray Hospital - CORRIGENDUM. Antimicrob Steward Healthc Epidemiol. 2023 Sep 20;3(1):e160. doi: 10.1017/ash.2023.437. eCollection 2023.
Ref 20 Erratum: Considerations for de-escalating universal masking in healthcare centers - CORRIGENDUM. Antimicrob Steward Healthc Epidemiol. 2023 Sep 15;3(1):e157. doi: 10.1017/ash.2023.438. eCollection 2023.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.